General Information

  • ID:  hor000807
  • Uniprot ID:  Q17AN4
  • Protein name:  Corazonin precursor-related peptide
  • Gene name:  Crz
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Corazonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0071858 corazonin receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045823 positive regulation of heart contraction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SSPEQTAPSRTLLPHIPLGMDKPDEECRLLIQ
  • Length:  32(35-66)
  • Propeptide:  MKHVFSTSLIVSLFVIFTDAQTFQYSRGWTNGKRSSPEQTAPSRTLLPHIPLGMDKPDEECRLLIQRFLKSPCDVRLANAIVNRNKDLLRDMADDVNDGTALLYDPVPMVDTAASEDVRFKRGTPDRRLLNDGMHRL
  • Signal peptide:  MKHVFSTSLIVSLFVIFTDA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in the physiological regulation of the heart beat
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q17AN4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000807_AF2.pdbhor000807_ESM.pdb

Physical Information

Mass: 412622 Formula: C154H255N43O50S2
Absent amino acids: FNVWY Common amino acids: LP
pI: 4.66 Basic residues: 4
Polar residues: 7 Hydrophobic residues: 8
Hydrophobicity: -58.13 Boman Index: -6352
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 88.44
Instability Index: 9434.69 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA